SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395019.Bmul_0357 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395019.Bmul_0357
Domain Number 1 Region: 731-973
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.22e-24
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.022
Further Details:      
 
Domain Number 2 Region: 27-229
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000141
Family Pyruvate oxidase and decarboxylase PP module 0.061
Further Details:      
 
Domain Number 3 Region: 441-628
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000311
Family Pyruvate oxidase and decarboxylase PP module 0.033
Further Details:      
 
Weak hits

Sequence:  395019.Bmul_0357
Domain Number - Region: 275-400
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00149
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 395019.Bmul_0357
Sequence length 1190
Comment (Burkholderia multivorans ATCC 17616 JGI)
Sequence
MTARLPIDGTPALSDYRLTDNLTATRGRIFLTGTQALIRLLLMQRASDTAQGLNTAGFVS
GYRGSPLGMVDQQLWKAKKLLDASGVRFLPAINEELGGTAVLGTQRVEADPERTVDGVYA
MWYGKGPGVDRAGDALKHGNAYGSSPHGGVLVVAGDDHGCVSSSMPHQSDFAMIAWHMPI
VNPSNIADMLEFGLYGWALSRYSGAWVGFKAISETVESGSTVDLDALQTQWPAPQGYTPP
AGGLHNRWPDLPSLTIEARLAAKLDAVRHFARTNSIDKWIAPSARANVGIVTCGKAHLDL
MEALRRLDLTVDDLDAAGVRIYKVGLSYPLELTRIDTFVDGLDEVLVIEEKGPVIEQQIK
DHLYNRTEGARPRVLGKHDAAGACLLSELGELRPSRILPVFAEWLARHKPALDRRERVVD
LVAPQILSNEADAVKRTPYFCSGCPHNTSTKVPEGSIAQAGIGCHFMASWMDRDTTGLIQ
MGGEGVDWAAHAMFTNTKHVFQNLGDGTYFHSGILAIRQAVAAKANITYKILYNDAVAMT
GGQPVDGSISVPQIARQVEAEGVSRFVVVSDEPQKYDGHHGLFPAGTTFHHRSELDAVQR
ELRETPGVTVLIYDQTCAAEKRRRRKKGEFPDPDKRLFINDAVCEGCGDCGVQSNCLSVE
PLETPLGRKRRIDQSSCNKDYSCVNGFCPSFVTVEGAALKKAAGAAFDEAALAARVDALP
VPATHLDAAPYDMLVTGVGGTGVVTVGALISMAAHLEGKSASVLDFMGFAQKGGSVLSFV
RIASSDRWLNQVRIDTQQADVLLACDMVVGASAEALQTVRRERTRIVVNTHSIPNASFVQ
NPDANLHADALLAKMRHAAGDGFMSSCDAQALAAKFLGDTIGANILMLGYAWQLGLVPVS
LAAMMRAIELNNVAVPMNKLAFSVGRMAAGDPAALDALWNARHAVAVHAAPQTLDELIAD
REARLHAYGGARYVERYRALVGAARAKGDDALTHAVATTFYRLLAVKDEYEVARLYADDA
FRASLEAQFEGVPGQDYRVKFNLAPPTVAKAGSDGGAPKKRVFGQWMWPVLGMLARVRNL
RGTWLDPFGRTVERRMERALADDYETTLTRAFAAMTTDNAARVVQLADLHARVRGFGHVK
LRNLAGVKRAERELALQLGIDAATSAAVREALDELKGAGMLKGIPVVVAK
Download sequence
Identical sequences A0A0H3KHV7
WP_012212601.1.54573 WP_012212601.1.74059 395019.Bmul_0357 gi|189351691|ref|YP_001947319.1| gi|189351691|ref|YP_001947319.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]