SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395019.Bmul_1258 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395019.Bmul_1258
Domain Number 1 Region: 150-287
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 1.44e-50
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000165
Further Details:      
 
Domain Number 2 Region: 56-145
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 2.62e-27
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00037
Further Details:      
 
Domain Number 3 Region: 3-56
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000102
Family TS-N domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 395019.Bmul_1258
Sequence length 293
Comment (Burkholderia multivorans ATCC 17616 JGI)
Sequence
MAAITASMVAELRAKTDAPMMECKKALTEADGDMAKAEELLRVKLGNKASKAASRVTAEG
VVASFVGGNAGALVELNCETDFVAKNDDFNAFAKQVAELVATKNPVDVAALSALPLDGKT
VDEVRLALVGKIGENISIRRFVRFETANKLATYLHGSRIGVMVEYTGADEQVGKDVAMHV
AAMKPVSLSADEVPADLIEKERRVAEQKAAESGKPAEIVAKMVDGSVQKFLKEVSLLNQP
FVKNDKQTIEQMLKAANAAVQKFALFVVGEGIEKRQDDFAAEVAAQVAAAKQQ
Download sequence
Identical sequences A9AIL5
gi|189350814|ref|YP_001946442.1| 395019.Bmul_1258 WP_012213138.1.42384 WP_012213138.1.54573 WP_012213138.1.66141 WP_012213138.1.74059 gi|189350814|ref|YP_001946442.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]