SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395491.Rleg_3433 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395491.Rleg_3433
Domain Number 1 Region: 123-380
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.55e-72
Family D-glucarate dehydratase-like 0.00013
Further Details:      
 
Domain Number 2 Region: 12-135
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.77e-31
Family Enolase N-terminal domain-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 395491.Rleg_3433
Sequence length 381
Comment (Rhizobium leguminosarum bv trifolii WSM1325)
Sequence
MDSVQRSTGQAILISDVVAHPLSQTLPKPTVTSWGTYHKVSMVLVEVRTDAGIVGVGEVL
ARFSPKAYAELIETSLKPRLIGQDARNIGALWQSMRRSLSGRAGGMLIEAIAGVDIALWD
IMGKAAGMPIAKLLGGIGREAIEVYAAAVNWVDDAEADRELERYIGEGFPRIKVKMANPV
REACRRIERLRKRAGDDIELCVDANWAYDLDQAIEVGRALSANGYFWFEEPLAPENEQGY
VELRKRCDVPLAAGESNFTADQAQRLVANRTLSILQPDVARAGGISETRRMADYAALHDV
GYAPHIGMSGIICETASAHLAAALPNFRVMECECDLSPFKRDLADLAPGCLRQKNGRLDV
PTRPGLGIEIDWGAVKRLRIQ
Download sequence
Identical sequences C6AV82
WP_012758792.1.14669 WP_012758792.1.67177 gi|241206122|ref|YP_002977218.1| 395491.Rleg_3433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]