SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395491.Rleg_3608 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  395491.Rleg_3608
Domain Number - Region: 95-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00196
Family NfeD domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 395491.Rleg_3608
Sequence length 151
Comment (Rhizobium leguminosarum bv trifolii WSM1325)
Sequence
MLAKIVAELGPWSWWVAGLVLLAAEMIVPGFFLVWIGLAALIVGALSLLFWDSAFWVWEL
QAILFALFAVAATFAGRRLTLRNATTDEPFLNQRGASLVGRTATLHEPIREGRGRIRLDD
TLWQVMGPDLPVGTQVKVVSSNGRDLTVEPV
Download sequence
Identical sequences C6AW31
gi|241206296|ref|YP_002977392.1| WP_012758942.1.14669 395491.Rleg_3608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]