SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395491.Rleg_4981 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395491.Rleg_4981
Domain Number 1 Region: 131-386
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.59e-77
Family D-glucarate dehydratase-like 0.00013
Further Details:      
 
Domain Number 2 Region: 1-146
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.69e-32
Family Enolase N-terminal domain-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 395491.Rleg_4981
Sequence length 389
Comment (Rhizobium leguminosarum bv trifolii WSM1325)
Sequence
MRIKTVEAWWIKIPIEASRQHRSDFGRLTTFDSAILRIETDDGIVGWGEGKNAAGSSGTY
GTLVHMLNHEIGPKLIDRDPADISTIWEMLYNGVRHETAASSGHAMPEIARRGLSVAAIS
AVDIALWDILGKSLGVPVWKLLGGRKADRLPAYASGGWESVDRIGEQLRSYVAAGGFKSV
KMRVGAMDRALHVSASRVRAARKAIGPDVDLMVDAHGTYTVAEAKRFIQMVADCDLAWFE
EPVIADDKPGMAEVRAAGNVPIAAGESEATRFAFRDLAMLRAADIFQPDPAFCGGITEAM
RISSLASAFNLRFAPHLWAGAPCFFSGLHLCAASPASFIIEYSLGANPMIHDLVEDTVSV
KDGMVEIPDRPGLGFTINQRVLETHAQRQ
Download sequence
Identical sequences C6B537
395491.Rleg_4981 WP_003562969.1.14669 WP_003562969.1.67177 WP_003562969.1.99504 gi|241113321|ref|YP_002973156.1|NC_012848 gi|241113321|ref|YP_002973156.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]