SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395491.Rleg_5336 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395491.Rleg_5336
Domain Number 1 Region: 65-289
Classification Level Classification E-value
Superfamily MetI-like 2.22e-58
Family MetI-like 0.0000455
Further Details:      
 
Weak hits

Sequence:  395491.Rleg_5336
Domain Number - Region: 19-53
Classification Level Classification E-value
Superfamily MalF N-terminal region-like 0.000589
Family MalF N-terminal region-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395491.Rleg_5336
Sequence length 310
Comment (Rhizobium leguminosarum bv trifolii WSM1325)
Sequence
MSMVNPEDRRGPISSLLQNNNVLGFLFMLPAAVFLVCFLTYPLGLGVWLGFTDTRIGRDG
VFIGLENYQFLMDDSVFWLSVFNTILYTSVASVLKFALGLWLAMLLNQHLPFKSFFRAIV
LLPWVVPTVLSALAFWWIYDSQFSIISWSLMQLGLINGPINFLGDPINARISVIVANVWR
GIPFVAISLLAGLQTIPASLQEAASLDGATSWQRFRYVTLPMLTPIIAVVMTFSVLFTFT
DFQLIYVLTKGGPVNATHLMATLSFQRGIPGGQLGEGAAIAVAMVPFLLGAIMFSFFGLQ
RRKWQQGGQD
Download sequence
Identical sequences C6B631
WP_012755639.1.14669 WP_012755639.1.67177 gi|241113665|ref|YP_002973500.1|NC_012848 gi|241113665|ref|YP_002973500.1| 395491.Rleg_5336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]