SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395491.Rleg_5700 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395491.Rleg_5700
Domain Number 1 Region: 113-351
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.44e-45
Family D-glucarate dehydratase-like 0.00047
Further Details:      
 
Domain Number 2 Region: 8-129
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 0.00000000000202
Family Enolase N-terminal domain-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395491.Rleg_5700
Sequence length 382
Comment (Rhizobium leguminosarum bv trifolii WSM1325)
Sequence
MPLSGFRITRFQFARDRVIGDSQVRADDVNVAALELIGETGKVGLGFIQTLFHPLPDQAE
IEAVFKHEAWPAIAGQEAIGLVHRVNRPRGGNQRAFSLPFHEALQVALWDLAAKEVGLPL
HKLLGSRRDRVRAYASGLDFHLSDEAFRALFSHAAALGYQAFKIKVGHPDFRRDMRRLDL
LKEVVPAGSQIMIDPNEAWNSKEALVKLTAIRDAGHDLLWVEDPILRHDFEGLRTLRHAV
NWTQINSGEYLDASGKRLLMENFATDLLNVHGQVTDVMRIGWLAAELGIPVCLGNTFLEV
GVHMAVALPEVEWLEYSFQNFDHLVEQPILIRDGFAYAPDRPGHGLVLSEVSREQWSRPK
RLIGSELGEPPENSRLPRLNGM
Download sequence
Identical sequences C6B9B4
395491.Rleg_5700 gi|241518425|ref|YP_002979053.1|NC_012853 gi|241518425|ref|YP_002979053.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]