SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395492.Rleg2_3306 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  395492.Rleg2_3306
Domain Number - Region: 95-151
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00262
Family NfeD domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 395492.Rleg2_3306
Sequence length 153
Comment (Rhizobium leguminosarum bv trifolii WSM2304)
Sequence
MLAKIVAELGPWSWWVAGLVLLAAEMIVPGFFLVWIGLAALIVGALSLLFWDSAFWVWEL
QAILFALLAVATTFAGRRLTLRNSTTDEPFLNQRSASLVGRTATLHEPIREGRGRIRLDD
TLWQVMGPDLPAGTQVKVVSSNGRDLTVEPVSV
Download sequence
Identical sequences B5ZQ03
395492.Rleg2_3306 gi|209550882|ref|YP_002282799.1| WP_012558916.1.20038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]