SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395492.Rleg2_3479 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395492.Rleg2_3479
Domain Number 1 Region: 95-359
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.97e-79
Family D-glucarate dehydratase-like 0.0001
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.86e-31
Family Enolase N-terminal domain-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 395492.Rleg2_3479
Sequence length 382
Comment (Rhizobium leguminosarum bv trifolii WSM2304)
Sequence
MKITKLTTYIVPPRWLFLKIETDEGIIGWGEPVVEGRALTVQAAVHELEDYLIGKDPFLI
EDHWTVMYRGGFYRGGAVHMSAISGIDQALWDIKGKALGQPIHSLLGGQLRDRIKVYSWI
GGDRPADVANNAREVVARGFKAIKLNGCEEMQIVDTNEKVEKAVETIAVIREAIGPHIGI
GVDFHGRVHKPMAKVLAKELEPYKLMFIEEPVLSENKEALRDIVNHTSTPIALGERLFSR
WDFKQVLSDGYVDIIQPDLSHAGGITECRKIAAMAEAYDVALAPHCPLGPIALAACLQVD
AVSYNAFIQEQSLGIHYNKGNDILDYISNKEVFQYADGFVSIPQGPGLGIEVDEAYVIER
AREGHRWRNPIWRHADGSFAEW
Download sequence
Identical sequences A0A0N1MDC3 B5ZR24
WP_012559050.1.20038 WP_012559050.1.46073 395492.Rleg2_3479 gi|209551055|ref|YP_002282972.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]