SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395492.Rleg2_3673 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395492.Rleg2_3673
Domain Number 1 Region: 89-391
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.54e-55
Family D-glucarate dehydratase-like 0.0006
Further Details:      
 
Domain Number 2 Region: 1-106
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.03e-22
Family Enolase N-terminal domain-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 395492.Rleg2_3673
Sequence length 399
Comment (Rhizobium leguminosarum bv trifolii WSM2304)
Sequence
MKITDLRCAVIGKHPIVRIVTDEGLYGLGEVEFTKSYLKPWVLHFRDALIGEDPTDVERV
MLKIRQRGSFKPYGAAVSAIEHALWDIAGKAAGVPAYKLLGGKVRDKVRVYNGSVRRKRT
GDRPEDYAADVKWMMEQPQNFFMIKQGISFHSNMKDTIEDFHYGVTQKKAGYHGAMDQGV
ISERCFNHMLDCVIAMKEVLGDKVSLALDCGPGWMLPDAIKFARAVEKYNLMWLEDMLTG
DYVPWVNPQAYRELTTSTSTPIHTGEQIYLRHNFKELIETQAVRVIGPDPADIGGIAELK
WVAEHAYMHSILMAPHGTANGLLGLGALINVCATLPANYVAFEYPSASDPWWEDLVIGLP
PQIVKDSMVDLLEAPGLGLDIDAEAARKYLSEEDVDFFD
Download sequence
Identical sequences B5ZSQ8
gi|209551245|ref|YP_002283162.1| 395492.Rleg2_3673 WP_012559202.1.20038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]