SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395492.Rleg2_4390 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395492.Rleg2_4390
Domain Number 1 Region: 40-223
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.22e-21
Family Clp protease, ClpP subunit 0.055
Further Details:      
 
Domain Number 2 Region: 401-460
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000144
Family NfeD domain-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 395492.Rleg2_4390
Sequence length 467
Comment (Rhizobium leguminosarum bv trifolii WSM2304)
Sequence
MYVPQIVTRGSRCWRWQPPIFTLLFLLLSALAFAAPSAANRAAVVLKVNGAIGPAIADYV
TRGIQRAGERGAVLIILQMDTPGGLDTSMREIIRAILASPVPVASFVAPSGARAASAGTY
ILYASHIAVMAPGTNLGAATPIALGVKPFGGDAEPEKKPGEPSGKQPEAPGNAHEAKAVN
DAVAYIRGLAELRNRNADWAERAVREAASLSSTAAVREHAIDFMAVDVNDLLAKAQGQTV
RVGQTDVRLDTAGLAVQEFEPDWRTRLLSVITDPNIAIILMMVGIYGLIFEFLAPGTMFP
GTIGGICLLLGLYALALLPVSFAGLGLIFLGVGLTVAEAHSASFGALGIGGGVAVILGAT
ILFDTDIPGLEVSRPLLGAIAFATLAFSLVVARLAFTSRVRRVATGAEEMIGISGKVESW
TGLTGYVIAHGERWKAVSAEPLAAGDPVSVTGRNGLALEVVSRPKDI
Download sequence
Identical sequences B6A2H5
395492.Rleg2_4390 gi|209546470|ref|YP_002278388.1| WP_012555468.1.20038 gi|209546470|ref|YP_002278388.1|NC_011368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]