SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395495.Lcho_3389 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395495.Lcho_3389
Domain Number 1 Region: 6-85
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000053
Family Anti-sigma factor antagonist SpoIIaa 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 395495.Lcho_3389
Sequence length 87
Comment (Leptothrix cholodnii SP 6)
Sequence
MLSLPERLTHVETPPTLRSLFAEMDALPAGTSVVIDGHQLGRFDSSALGLLLSCRRHAQT
HGRGFSTQALPQRLVRLASLYGLSGCI
Download sequence
Identical sequences B1Y2Z1
395495.Lcho_3389 gi|171060063|ref|YP_001792412.1| WP_012348394.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]