SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395495.Lcho_3797 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395495.Lcho_3797
Domain Number 1 Region: 11-94
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.63e-18
Family Anti-sigma factor antagonist SpoIIaa 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 395495.Lcho_3797
Sequence length 110
Comment (Leptothrix cholodnii SP 6)
Sequence
MDTDPKTGDAPRTLRIQGELSIFRATELKQALLAEPAATEIDLSGVTDIDTAGLQLLMLA
KKHARRSGREVRLVGHSPAVIELFELLHIAGHFGDPMVIDAPARDAPHRN
Download sequence
Identical sequences B1Y6M3
395495.Lcho_3797 gi|171060467|ref|YP_001792816.1| WP_012348798.1.27902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]