SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395960.Rpal_0945 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  395960.Rpal_0945
Domain Number - Region: 91-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00536
Family NfeD domain-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395960.Rpal_0945
Sequence length 149
Comment (Rhodopseudomonas palustris TIE 1)
Sequence
MTAILTALGAWNWLILGLVLMALELLAPGVFLFWLGLAALLVGVLALLLEPGWQLQILLF
GLFAAAAVPLWRRMARGGDVEVHATNPFLNRRTDALVGREFTLEKPIEGGVGTVRIDDTV
WRVSGPDTPAGSRIRIVAADGVKLTVAAL
Download sequence
Identical sequences B3QF68
WP_012494545.1.13849 395960.Rpal_0945 gi|192289373|ref|YP_001989978.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]