SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395960.Rpal_1231 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395960.Rpal_1231
Domain Number 1 Region: 10-165
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.43e-31
Family GHMP Kinase, N-terminal domain 0.00016
Further Details:      
 
Domain Number 2 Region: 167-294
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 3.17e-25
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 395960.Rpal_1231
Sequence length 299
Comment (Rhodopseudomonas palustris TIE 1)
Sequence
MTDGSAMTLRDEARAKVNLTLRVVGRRPDGYHELESVVAFADCADHLTLQPGAALSLTTI
GPGAQDCGDSADNLVLKAARLLGERVPDLTTGAFTLDKHLPVAAGIGGGSADAAAALRLL
ARANDLAVDDPRLVEAARLTGADVPVCLPSKPCVMTGVGEKLSPLPLPRIPAVMVNPRVP
VATKDVFTALGLKPGSLAVGATDVLAAPAWPEAGAALANWVVALEAGTNDLEPPALKVEP
VVGTVLEALRATAGVQLARMSGSGATCFALYADDASARAAADALCAAHPGWWVHAGSLS
Download sequence
Identical sequences B3QHL3
395960.Rpal_1231 WP_012494774.1.13849 gi|192289641|ref|YP_001990246.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]