SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 395960.Rpal_1418 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395960.Rpal_1418
Domain Number 1 Region: 26-253
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 7.06e-47
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.01
Further Details:      
 
Domain Number 2 Region: 237-304
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000000113
Family 7-Fe ferredoxin 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 395960.Rpal_1418
Sequence length 314
Comment (Rhodopseudomonas palustris TIE 1)
Sequence
MNEQSNIAVNADSEPVAFNAALAEPTNVLIVGVGGQGVIMVSKVLASLAQAHGYEVKQSE
VHGMAKRGGTVFSHVRFGPRVWSPTIAKGEADVLIALEWAEGLRWLPHLKRDTGVFICDT
KRIVPPFACLSRRLGAPMRYSTETAEQVAAYVSEAYAIDATKMAEELGNERAANVVLLGA
LSTVLEFALPEWEKTVTAFVPKKTIAVNSAAFELGRNWIADAKSEPATSDAALPSEPTHT
PYRPRLEITDAWCKSCEICVKLCPERCLKLNADRVVELVAPEKCTGCRLCEWLCPDFAIR
VHLDTEAPAMEAAQ
Download sequence
Identical sequences B3QJ76
WP_012494908.1.13849 gi|192289828|ref|YP_001990433.1| 395960.Rpal_1418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]