SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395960.Rpal_1554 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395960.Rpal_1554
Domain Number 1 Region: 714-959
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.1e-22
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.024
Further Details:      
 
Domain Number 2 Region: 22-207
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2e-19
Family Pyruvate oxidase and decarboxylase Pyr module 0.079
Further Details:      
 
Domain Number 3 Region: 429-616
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.000000000011
Family Pyruvate oxidase and decarboxylase PP module 0.068
Further Details:      
 
Domain Number 4 Region: 270-344
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000000404
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.078
Further Details:      
 
Weak hits

Sequence:  395960.Rpal_1554
Domain Number - Region: 1123-1147
Classification Level Classification E-value
Superfamily Docking domain A of the erythromycin polyketide synthase (DEBS) 0.017
Family Docking domain A of the erythromycin polyketide synthase (DEBS) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 395960.Rpal_1554
Sequence length 1155
Comment (Rhodopseudomonas palustris TIE 1)
Sequence
MTEPSKLPNVTLSDKYEQPEGEVFLSGNQALVRLVLQQRARDAATGLNTAGFVSGYRGSP
LGRLDMELWQSGDLLHKAQVKFQPGVNEDLAATAVWGSQQVGSFAGARYDGVFGIWYGKG
PGVDRSGDAIKHANAAGVAPLGGVLALAGDDHGAKSSTQAHQSDYAFIAAGIPVLYPANV
QEILDYGLHGLAMSRHAGCWVALKLVTDVVEGSSSVRVGLDSPAIVVPSQPAGDVHIKRI
AMPKAQEEALYRLRLPAAMAYARANALNRIVAAAPDARIGVVTAGKSYADTRAALDRLGG
RDGFHPDSVRLLKIGMVWPLDPEIVRQFARGLDTILVVEEKRPLLEDQIKAILFDDAAGP
RPRVIGKFVGVSAWDAGRGTEVFAMTGELSPDLIATRIADGLRLSPASAPSRALALANAT
TPERAPTFCSGCPHSTSTRLPDGSLALAGIGCHSIALLQNPMRTGPLAHMGAEGVMWVGM
APFTDMPHVFANMGDGTYFHSGFLAIRQAIAAKSTITYKVLVNGFVSMTGGQPIEGELTP
AQLATELLTEGVAKVVVVADDPQKYQGVALPVGVRVEHRERLELVQKELREVAGVSVLIY
DQMCATERRRQRKRGKMPDPGTRTFINSAVCEGCGDCGEASNCLSVEPLETDYGRKRRIN
QASCNKDLSCVQGFCPSFVTVVGGSLRKPVKTAPRAATTETLPEPVLPTLADPIGVIVAG
VGGTGVITLGAVIGMAAHLDGIAVSTLDLTGLAQKYGAVTSHIRLARTPDRLSTHRLADG
DADVAIGADLIVAAGAETVAKLDAARTRTVVDAAINPTRDFSVDPDWSVDDRALIGRLEA
ATRETLALEATEIARRLVGDPLGANMLLLGFAWQKGWLPLSRAALEQAIRLNAVAVDLNL
TSFGWGRALAHDPAMVRAAAFPPVQQPTAAANDTLDELVARRAADLTDYQNAALAESYRA
FVAKVADREQRLGQGNALARAVARNYYKLLAVKDEYEVARLYTSLAFRRELEQTFDGEFT
LRFHLGAGPFARHVDGIATPKKTEVGPWMMKAFHVLAALRRLRGSLLDPFRNNPERRLAD
RERDRYEADLDRLIAELDADRLGVAVEIASLPDKLRGYGHVRERAADDVQQRREALWRRW
EHRRSEPAREKEAAL
Download sequence
Identical sequences B3QK71
395960.Rpal_1554 WP_012495014.1.13849 gi|192289958|ref|YP_001990563.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]