SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395960.Rpal_3608 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395960.Rpal_3608
Domain Number 1 Region: 718-962
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.27e-29
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0051
Further Details:      
 
Domain Number 2 Region: 43-206
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000033
Family Pyruvate oxidase and decarboxylase Pyr module 0.039
Further Details:      
 
Domain Number 3 Region: 436-620
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000124
Family Pyruvate oxidase and decarboxylase PP module 0.069
Further Details:      
 
Domain Number 4 Region: 271-387
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000102
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395960.Rpal_3608
Sequence length 1161
Comment (Rhodopseudomonas palustris TIE 1)
Sequence
MGIDQGPISLDQKYTQHSGHVFLTGIQALVRLPMAQVRRDRAAGLNTAGFVTGYRGSPLG
GYDQQLVAARHHLEQYNVKFQPGVNEDLAATAIWGTQQLNLSPGAKYDGITGIWYGKGPG
VDRCGDVFRHANAAGSAKNGGVLCLAGDDHGAKSSTVPHQSDHAFIAALMPYLYPSSIHE
MIEMGLLGIAMSRYSGCWVGMKVITETVETTAEINLADEMTPFVIPTDFEMPPGGLNLRW
PDDRYDQDRRLQDYKGFAAIAFARANKVNRITMDSPNARFGIMASGKSYEDVRQALRELG
VDEQVAAKIGLRLYKIGMPWPLEPEGVQEFARGLEEIFVVEERREIVENQVKQLLFGMRE
RPRVIGKMDDHNHRFLPFAEELSVAKVATSMVDRLLAMEIDPTIAEMLRAKADWFHGRDA
SQVQAVVPIARTPYFCSGCPHNTSTKVPEGSRALGGIGCHFMSLWMDRSTETFTHMGGEG
VPWTGIAPFTDEKHIFANLGDGTYFHSGSLAIRQSIASKANITYKILYNDAVAMTGGQRH
DGDLSPQQITYQLHSEGIREIYLVSETPDAYPADSIAPGTHLRHRDELDAVMKECREIKG
ASAIVFVQTCAAEKRRRRKRGLMEDPARRVMINAAVCEGCGDCSVQSNCISVEPLETELG
RKRAINQSTCNKDYSCLKGFCPSFITIDGGKLRKRAAVDLGDLGSLPEPAARPGLDKPYN
VAVGGVGGTGVLTIGALLGMAAHIEGKASMILDMSGLAQKGGAVLSHVRLSNKPEDVTCS
RIVSGSADVLIVADEVMAISKETLSLCEASRTHGVVNTHLIPISDFIRNRDFDFQTRKVN
SVLEAALRKDSAFLDFTKAAETLLGDSIATNMMMMGFAYQLGLLPLSATAIEQAIELNGV
SIKMNTQAFRLGRLAAADPARLASLLHGADHSVAGKTQGEMSLDEIIAHRSALLTAYQSK
RLAKRYTDLVATVRSAADAGGYGEALPRAVALNYAKLLAYKDEYEVARLLTEPGFEQQIR
DQFEGDYKISFNLAPPILPGVDLTGRPKKRQFGEAMRPVFRTMAKLSFLRGTPLDPFGYH
PERKLERKLIADYEADVASVLQHLSPATIDTAVELLSMPDRIRGYGPIKQKSVDDTAPRF
AELRANLRDPQPAPPRQMAAE
Download sequence
Identical sequences B3QAY5
395960.Rpal_3608 WP_012496616.1.13849 gi|192291978|ref|YP_001992583.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]