SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395961.Cyan7425_0532 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  395961.Cyan7425_0532
Domain Number - Region: 118-157
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000379
Family NfeD domain-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 395961.Cyan7425_0532
Sequence length 167
Comment (Cyanothece PCC 7425)
Sequence
MDIESGLLIWRCSCAATFSDIYADMTTPWLWLVTGLLLCLAEVFFPTAFVAIALGVSALL
VALVALVVPNFVVQALLWLVLSTGLVWLSRPFVPRRSRPMLMDAVEAQTLTAIPPGRTGR
VLYEGNSWPARCEDHLLEIPVDEKVYVVRREGTTLIVLPERLIHSRS
Download sequence
Identical sequences B8HU03
gi|220905973|ref|YP_002481284.1| WP_012626024.1.77409 395961.Cyan7425_0532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]