SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395961.Cyan7425_3486 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395961.Cyan7425_3486
Domain Number 1 Region: 143-419
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.55e-123
Family Enolase 0.0000000616
Further Details:      
 
Domain Number 2 Region: 5-140
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.43e-52
Family Enolase N-terminal domain-like 0.00000833
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 395961.Cyan7425_3486
Sequence length 426
Comment (Cyanothece PCC 7425)
Sequence
MFETAIAAITAREILDSRGRPTVEAEVELECGAIGLAQVPSGASTGSFEAHELRDGDAQR
YGGKGVLKAVQNIQEQIKPHLLGSDALKQELIDRKMIGLDGSANKASLGANAILAVSLAT
AKAGAEALGLPLYRYLGGPLANLLPVPLMNVINGGAHADNNVDFQEFMIVPHGASSFREA
LRWGAEVFAALSKVLHDKGLLTGVGDEGGFAPNLPSNQAALDLLMTAIAKAGFKPGEEIS
LALDVAASEFYQDGQYSYDGAAHSPSELIDYLATLSEQYPIVSIEDGLQEDDWQHWQQLT
SKIGHRVQLVGDDLFVTNPIRLDKGIKERAGNAILIKLNQIGSLTETLQTIDLATRNRYR
SIISHRSGETEDTTIADLAVATRAGQIKTGSLCRSERVAKYNRLLRIEDELGAQAIYAGT
IGMGPG
Download sequence
Identical sequences B8HQY9
gi|220908860|ref|YP_002484171.1| 395961.Cyan7425_3486 WP_012628870.1.77409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]