SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395962.Cyan8802_0479 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  395962.Cyan8802_0479
Domain Number - Region: 86-136
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00262
Family NfeD domain-like 0.017
Further Details:      
 
Domain Number - Region: 13-64
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0418
Family LacY-like proton/sugar symporter 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395962.Cyan8802_0479
Sequence length 147
Comment (Cyanothece PCC 8802)
Sequence
MLSPSLLWLIAGAILCLMEVVFPVAFVAFMMGLSAIIVAAIALVIPAFSLQVILWLSFST
VLVVGSRRLLPKKKMLNANLRDAEEGETLTEIEPGKTGRVLYEGNSWQAKCADEKLAIAP
YQKVYIVTRKGNTLIVLPELLSPPDNS
Download sequence
Identical sequences B7JVJ0
gi|218245346|ref|YP_002370717.1| gi|257058383|ref|YP_003136271.1| WP_012593838.1.62203 WP_012593838.1.93053 395962.Cyan8802_0479 41431.PCC8801_0465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]