SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395963.Bind_1264 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395963.Bind_1264
Domain Number 1 Region: 404-483
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000163
Family Anti-sigma factor antagonist SpoIIaa 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395963.Bind_1264
Sequence length 492
Comment (Beijerinckia indica ATCC 9039)
Sequence
MNKNYLSRYRSEWFSGMTGVRRDVLAGMVGTFALIPEVIAFSFVAGVAPEVGLFASFVIG
VVIAFTGGRPAMISGAAGSVALVAAALVHDHGLQYLLAATLLVGVFQIVFGLLRLDVLMR
FVSRSVRTGFVNALAILIFSAQVPQMLGVTWHTYAMIAIGLGIIYLVPRLTTVIPSPLIC
ILVLTAISMMVPMPLHTVADLGRLPDSLPSLVIPHVPLNLGTLAIVAPYALAMAIVGLLE
SMMTASVVDDLTETTSSKAQECTGLGIANVAAGLFGGIAGCGMIGQTVGNIRYGGRGRLS
TLVAGLFLLVLMVLLRPWVARVPVAALVAIMIMVSISTFSWSSLRDLLHHPKVSSFVMLA
TVVVTVATRDLAAGVAVGVLLSGVFFAFKVMQLMDVQCDYNAEADTRVYRVSGQIFFASA
DMFADCFDLRDTARRVSIDLSDAHLWDITAVGALEGVVTKMRHHGIHVELIGLNAASANL
LDRHASLIQDET
Download sequence
Identical sequences B2IJN3
WP_012384262.1.21334 395963.Bind_1264 gi|182678248|ref|YP_001832394.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]