SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 395963.Bind_3668 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  395963.Bind_3668
Domain Number 1 Region: 8-100
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000471
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 395963.Bind_3668
Sequence length 377
Comment (Beijerinckia indica ATCC 9039)
Sequence
MPQNPSFSSEMLGDAMHFSLAGHWTLEWSKGLESAAADLLKALGKARKAVFNLAGVERLD
TAGAWLIDRTRRNLSERGVSTELDHVRPEYGILFQEAHFRTFPEPKRQNASFFVAPLVET
GKTVVEAGRETLRGMSFLGEAIASLAQSFVQRQHFRGISLVYQIETIGLRSVPIITLINF
LVGCIVAQQGLFQLRRFGASTFAVDLLGILTLRELGVLLTSIMIAGRSGSAITAEIGSMK
MREEIDALTVMGLRPIEVLIVPRLLALVISLPLLTFIADMAALAGGLLVSYSYGGIQPVA
FLNRLHDAISLHTFYTGLIKAPFMALVIGLIAAVEGFAVEGSAESLGRQVTTSVVKSIFM
VIVLDGLFAMFFAGINY
Download sequence
Identical sequences B2IGX4
WP_012386568.1.21334 gi|182680563|ref|YP_001834709.1| 395963.Bind_3668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]