SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 396513.Sca_1196 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  396513.Sca_1196
Domain Number 1 Region: 173-235
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000183
Family NfeD domain-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 396513.Sca_1196
Sequence length 238
Comment (Staphylococcus carnosus TM300)
Sequence
MSHPTGILHNISVFQTSQSPFMQYLGEIITSPLVSLILTCIIFLGFLYQLYSKRTNFAGI
IAALALLILFLGYLIQGEVSLISIGLFIIGIILLIIEFFIVGAIIGIIGIVLIAISMIML
GNNILWMLINVVIAFILSIIEWVILVKGFNKKLSLFEKVILRDSTTSEAGYTSHDDRSDL
VGQIAETLTELRPAGIISLNDERIDAVSDGTFIQRGVKVKVTQVEGTRVVVRELPQNS
Download sequence
Identical sequences A0A2K4EQ27 B9DNM0
gi|224476682|ref|YP_002634288.1| WP_015900444.1.20588 WP_015900444.1.31717 396513.Sca_1196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]