SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 396513.Sca_2394 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  396513.Sca_2394
Domain Number - Region: 7-46
Classification Level Classification E-value
Superfamily MalF N-terminal region-like 0.0101
Family MalF N-terminal region-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 396513.Sca_2394
Sequence length 138
Comment (Staphylococcus carnosus TM300)
Sequence
MKKILSIFIFLFLLIGMCFTGYLAFTADTHQKDQKDVSEKKDSKKESKKDKSHKDTNENN
QNAETEASIPTNQNYGTDYNNQTILPDGNTYDAQGTESNANTLDASVESNTEDNSGYAAQ
QEINAPGTEANSDPSVQQ
Download sequence
Identical sequences A0A2K4EJM5 B9DII4
396513.Sca_2394 gi|224477876|ref|YP_002635482.1| WP_015901632.1.20588 WP_015901632.1.31717 WP_015901632.1.88899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]