SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 396588.Tgr7_2129 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  396588.Tgr7_2129
Domain Number 1 Region: 36-146,189-248
Classification Level Classification E-value
Superfamily ClpP/crotonase 7.27e-28
Family Clp protease, ClpP subunit 0.03
Further Details:      
 
Domain Number 2 Region: 419-484
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000144
Family NfeD domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 396588.Tgr7_2129
Sequence length 496
Comment (Thioalkalivibrio HL EbGR7)
Sequence
MITAMGANRYARMFRLGVWALLLILGAVLAFAATGEDRQRSALLLDIDGAIGPATSDYVV
RGLKQARDEGAELVILRMDTPGGLDTAMREMIKEILASPVPVATYVAPAGSRAASAGTYI
LYASHIAAMAPATNLGSATPVAIGGMPGMPDEQPQRDDRSRDREDKETKETKDKEAEAGD
AAEERPAEPRRGTSPMERKVLEDAVAYIKGLAERHGRNAEWAEQAVREAVNLTYSEALAL
NVIDVVAESVEDLLKQIHGRTVKMDVGTRVLNTENLQVIQVEPDWRSRLLSVITNPNIAY
ILMMVGIYGIIFELANPGNIFPGVVGAICLVLALYAFQVLPINYAGLALIILGVVLMIAE
AFVPSFGILGFGGIAAFVVGSIILMDETTLSISIPLIGGTALVSAAFFIWVLSRLVAIRR
RKVVTGEEEMIGMEGTAMDEFVGNRGRVWLHSETWSAESPLPVAKDERVRVVGMQGLLLK
VEPITEHTETHKGAAT
Download sequence
Identical sequences B8GTW5
396588.Tgr7_2129 WP_012638687.1.30883 gi|220935297|ref|YP_002514196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]