SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 397948.Cmaq_0074 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  397948.Cmaq_0074
Domain Number 1 Region: 108-373
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.23e-79
Family D-glucarate dehydratase-like 0.0000381
Further Details:      
 
Domain Number 2 Region: 3-125
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.02e-23
Family Enolase N-terminal domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 397948.Cmaq_0074
Sequence length 395
Comment (Caldivirga maquilingensis IC-167)
Sequence
MPEISEVEPIILYNPRPDDPAPWASYMVLVRVVTKDGGVGWGETLSSIRVNALVQLIKVL
SSVMRGRDVFNLEGNRLEWYRQDFNMPVSLESTAAYSAFDIASWDIIGRELGAPVHRLLG
GLTRDRVRVYANGWYSNAVKPEDFAEKAKETVRRGYTALKFDPFGPYFDMIDSAGIKDAA
ERVKAVREAVGDGVDILIEAHGRFNAESAIRAAWALEPYNPLFMEEPVHPEDIEGLIRFR
NSTRIRVALGERIINKGYLIQYLKLSLVDYLQTDVGRFGGLTEARKASIMAEAFSVPMAF
HNANGPILHAATIQLDASIPNFAVQESFYDYWPQWKRDLVGDSMPVENGYVKVPTKPGLG
VDVNEKLIERLRINETEITIKGGLSWIVKGTTGGS
Download sequence
Identical sequences A8M9P7
WP_012185148.1.60673 gi|159040666|ref|YP_001539918.1| 397948.Cmaq_0074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]