SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 397948.Cmaq_0197 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  397948.Cmaq_0197
Domain Number 1 Region: 133-411
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.7e-80
Family Enolase 0.00000726
Further Details:      
 
Domain Number 2 Region: 5-128
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.79e-31
Family Enolase N-terminal domain-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 397948.Cmaq_0197
Sequence length 413
Comment (Caldivirga maquilingensis IC-167)
Sequence
MGTRISRLGIRKVFTGRGDLTVEVEVHLDDGWGRAIAPAGASRGKHEVKYFPDEGVDAAI
DVFKRWVEPGLIGMDAVNQVAVDKKLEEIDGTWDFSKIGGAVAVATSMANVVAVADSKGL
WPYQVIGGSLANVIPYPLGNTIGGGKHSRGLGPDYQEFLILPYGAPDIYTAVYTNMEVHR
EVGRILAKEDPTFAGGRNDEGAWTAKISTDKALEVLSSAVKEVSRRLGVEIGLGIDAASS
SMWNGKAYVYTNEGRELTPREHFERIKSIIEKYDLIYIEDPFHEEDFQSFAELTALFKDR
LIVGDDLFTTNPDRLAIGIREKATNAVLIKVDQIGTVTRAHETVRLALNNGYRIVVSHRS
GDTESGLLAHIAVGFKAPIIKTGIMGSERVAKANELLRIWDHLSGVARMAKIK
Download sequence
Identical sequences A8MAB4
WP_012185266.1.60673 gi|159040784|ref|YP_001540036.1| 397948.Cmaq_0197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]