SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 397948.Cmaq_1071 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  397948.Cmaq_1071
Domain Number 1 Region: 229-499
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.14e-57
Family PFOR Pyr module 0.017
Further Details:      
 
Domain Number 2 Region: 515-626
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.49e-20
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.03
Further Details:      
 
Domain Number 3 Region: 7-219
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000000000248
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 397948.Cmaq_1071
Sequence length 632
Comment (Caldivirga maquilingensis IC-167)
Sequence
MTVKLTWMIGGAQGSGVDTSASIFGNAVARAGYYIYGNREYHSNIKGRHSYFNLTISDVK
VNSLSDEVNILATFDAETVFQHFTEVKDYIIYDKALEGTKISAVQSMEPERAEKIEKILT
SSGYGTTIKDALNYAASKGVKIIPVDYGKIISEVASELKLPVSVVERARNLIASAVSLRL
LGIKLDYLRAALRVFFRNELYVKMNERASEKSYDLVQPAYNLAEIPVKGHRVQLDGNTAV
AIGKIAGGLRVQTYYPITPAADESMFIEDNEVVDVIDPETKELRKAGVLVFQSEDELSAV
NMAIGAALTGARAATATSGPGFSLMAEGIGWAGMNEAPVVITYYMRGAPSTGMPTRGQQA
DLLFAVNVSHGEFPRIVIASGDHVEAFWDAIWALNLAERYQTPVIHLVDKFLANSYSIID
EEELDYRNKKIIDRGKLMLKEVDDYKRFEFTDDGISPRIPLGYAVMHYTGDEHNEYGIIT
EESENRIRMYEKRLKKLETADKEIPEEQRLRVYGDESDIAVVTWGSPKGPAVDALQELKS
EGVNIQVIQVRMFNPYPRNLIRKLLEGKRMIIALEANYTAQAAQLMKLNTGIEPTHYVLK
WNGRPITRTEVKWAIKHILSTNEKKVVLNGGA
Download sequence
Identical sequences A8MDP4
gi|159041638|ref|YP_001540890.1| 397948.Cmaq_1071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]