SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 397948.Cmaq_1139 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  397948.Cmaq_1139
Domain Number 1 Region: 117-371
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.49e-52
Family D-glucarate dehydratase-like 0.00082
Further Details:      
 
Domain Number 2 Region: 3-133
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9.96e-21
Family Enolase N-terminal domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 397948.Cmaq_1139
Sequence length 380
Comment (Caldivirga maquilingensis IC-167)
Sequence
MPKLNTIKLIPVSIPYIDDPPTVFQEAWGRQLYVKVELGDLIGWGEVLVYGSNIIDSYIG
VFNDVIIPAVTGEVIENVGDVHRLVNKLEKLLFTAGLCGVVSGAMGGLEMALWDALGKYL
NKPISELLGVRIRDKVPVYASFPRYSTVDYVVKAVDKALSNGFNTVKLHQHVNDTVDSIK
AIRENMGYGVKVALDLNAAFNKPEEALNFLNKVHRYEPYWVEEPIWPPNNYELLTHVADK
SPVPIAAGENEYYIGGFKELARIKLMYIQPDVSKVGGLIRFMDIIKEASTLGKPVAPHHR
PHKSILTHLYTLHVASVVSNIAIVEWPLSWIKDIYNVDVEVKDGEVSLSRLMNSGVGVNV
NEEALGKYPYVSKYSPLVFH
Download sequence
Identical sequences A8MDW0
WP_012186185.1.60673 gi|159041704|ref|YP_001540956.1| 397948.Cmaq_1139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]