SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 398527.Bphyt_1334 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  398527.Bphyt_1334
Domain Number - Region: 432-505
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0191
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 398527.Bphyt_1334
Sequence length 526
Comment (Burkholderia phytofirmans PsJN)
Sequence
MNLRAFFSTFQRDLLAGTVVFLVALPLCLGIANASGVEPFAGLVSGIVGGLVVAVLSGSR
LSVSGPAAGLVVIVVDGIAQLGSFSAFLLAVLLSGAIQFGFGMLKAGRFAAYVPSPVIKG
MLAAIGVLLIVKQFPLALGLSGVNSAPGTQGVAQAAGAVATPFGSISLAACVITLLSLAI
LIGWETRAFRRFALVRRVPAPLAVVLLGIGATLLLSMLAPSLAPLAEHRVALPPLESFAA
LQLALEWADFGPHFAQLVNPDVWRVAITLAIVASLETLLSLEAVEQIDPERRAAPPDREL
KAQGVGNLIAGAIGGLPITSVIVRSSANVHAGAQSRLSAIIHGVLLLVSVFALTSVINLI
PLACLAAILIFTGLKLAKPSLFVAIAKQGFAPFAPFIVTLVGVLATDLLIGIVLGILCSV
LLALYANLRSPIVLAQHGDHYLLSFRKDVSFLGKVPLKHYLQQIPDGATLIVDATRADFV
DHDVRELLDTFVTDAPRRDIAVEVRHQVQAQARASRGWSMRRTATE
Download sequence
Identical sequences B2T2D8
398527.Bphyt_1334 gi|187923331|ref|YP_001894973.1| WP_012432368.1.30149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]