SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 398527.Bphyt_5652 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398527.Bphyt_5652
Domain Number 1 Region: 43-149,207-262
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.77e-24
Family Clp protease, ClpP subunit 0.076
Further Details:      
 
Domain Number 2 Region: 439-511
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000017
Family NfeD domain-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 398527.Bphyt_5652
Sequence length 522
Comment (Burkholderia phytofirmans PsJN)
Sequence
MSPIRGDMAGRLMRGMTVLGMLLAFGFASCESNVALRAAVAPNSVVVIPVNGAISPASAD
FIVRSLQRAAEDRAQLAVLQLDTPGGLDTSMRQIIKAILGSPVPVATFIAPSGARAASAG
TYIVYASHIAAMAPGTNLGAATPIQMGIGGAEPPGGGGTPGLPGVGGGGTGGGGHAGGAG
NDAGDTGAGNPSKPAASAPTGPASALPLDTQSTEMRKQVHDAAAYIRGLAQMRGRNADWA
ERAVREAVSLSAADALAQHVVDLNARDVPDLLRQVDGRTLVTSAGNVKLDTANARIVTLE
ADWRSHFLAVITDPNVALILLMIGMYGLFFEFANPGFVLPGVVGAISLLLGLFAMQMMPI
NYVGLGLIFLGIAFLIGEAFLPTFGSLGFGGVVAFVIGALMLIDTDVPGYGIPLPMIAAV
TVFSVVFVLGVSRLALSARRRPVVTGSEAMIGSVGVVLDGGLSPADLTADGALAGWAQVH
GERWRVSSTAPVAAGHAVRVTARRGLTLTVVPTEARQQGEGS
Download sequence
Identical sequences B2TFJ1
398527.Bphyt_5652 gi|187920338|ref|YP_001889369.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]