SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 398527.Bphyt_5689 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398527.Bphyt_5689
Domain Number 1 Region: 137-385
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.55e-64
Family D-glucarate dehydratase-like 0.0008
Further Details:      
 
Domain Number 2 Region: 34-154
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.62e-26
Family Enolase N-terminal domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 398527.Bphyt_5689
Sequence length 392
Comment (Burkholderia phytofirmans PsJN)
Sequence
MAMPTIRHVRAFIVRGGGADYHDQPGGHWIDDHISTPMARYPEYRQSRQSFGINVLGTLV
VEIEASDGTVGFAVTTGGEIGAFIVEKHLARFLEGQLVTDIEKMWDQMYFSTLYYGRKGV
VLNTISGVDLALWDLLAKVRKEPVYQLLGGPVRDELVFYATGARPDLAKEMGFIGGKLPL
QHGPAEGEAGLKQNLEKLADMRSRVGDDFWLMYDCWMSLDVPYATRLAQAAHEYGLKWIE
ECLPPDDYWGYAELRRNVPRGMMVSTGEHEATRWGFRMLLEMQCCDLIQPDVGWCGGITE
LIKISALADAHNVMVVPHGSSVYSYHFVVTRHNSPFAEFLMMAPKADEVVPMFTPLLLDE
PVPVNGRMKVPDTPGFGVRLNPECALVRPYPR
Download sequence
Identical sequences B2TFM7
gi|187920374|ref|YP_001889405.1| WP_012427543.1.30149 398527.Bphyt_5689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]