SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 398527.Bphyt_6284 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398527.Bphyt_6284
Domain Number 1 Region: 137-396
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.31e-73
Family D-glucarate dehydratase-like 0.00000654
Further Details:      
 
Domain Number 2 Region: 5-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.25e-23
Family Enolase N-terminal domain-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 398527.Bphyt_6284
Sequence length 424
Comment (Burkholderia phytofirmans PsJN)
Sequence
MTRDITVTQVRITPIAFRDGPLLNAAGIHEPWALRAIVELETSDGRVGISETYGDEPMLR
VLEQAKALVIGLSPFDLNRMEERVRAAIKPSSGAIEFELAPGSHSAKNAPKVISTLEVAM
LDLQGQIVGAPIVDLLGGKVRDAVPYSAYLFFKYAEHIDKPYAPDAWGEGLSADQIVAQA
RRMIDLYGFQSIKLKGGVFEPAHEIACMRALHRAFPGVPLRLDPNANWTLETSIAAAPEL
DELLEYYEDPCPGLAGMAELAKHTRLPLATNMVITTMEDFRRGAEMGSVKVLLSDHHYWG
GLRATQTLARMCKLWDLGMSMHSNSHLGISLMAMTHVAASIPNLTYACDTHYPWQEEEVI
KGGRVSFDNGAVRVPSAPGLGVELDRERLAELHAQYLTCGVRNRDDLKQMQKYDPSFSGK
NPRF
Download sequence
Identical sequences B2TB15
398527.Bphyt_6284 WP_012428119.1.30149 gi|187920950|ref|YP_001889982.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]