SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 398527.Bphyt_6386 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398527.Bphyt_6386
Domain Number 1 Region: 121-372
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.83e-65
Family D-glucarate dehydratase-like 0.00031
Further Details:      
 
Domain Number 2 Region: 16-134
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.77e-30
Family Enolase N-terminal domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 398527.Bphyt_6386
Sequence length 373
Comment (Burkholderia phytofirmans PsJN)
Sequence
MTDRTATHRAAQAPVNRLRASAYRIPTDAPEADGTFSWKATTLVVVEVEAAGQTGIGYTY
SDKSLVTLVHDALGECVLHSDVWDIRAIWQRMQRQVRNLGRSGLAATAISATDCALWDLK
AKLLGVPLVRLLGAARESVPLYGSGGFTTYSDKQMREQLAGWVERDGCRWVKIKIGTDPQ
KDPGRVETARAAIGDAGLFVDANGAFTPQQALHWAQRFAQQRVEWFEEPVSSDDPAGLHF
VRGHAPAGMEIAAGEYGYTLDDFRQLLAAQSVDVLQADVSRCGGITGFMQAADLCDAFHV
PLSAHCAPALHLHVACAVPRLRHQEWFHDHVRIESMLFDGAPQAIDGTIAPDLTRPGCGL
ELKSRDAAAYQVQ
Download sequence
Identical sequences B2T8N9
398527.Bphyt_6386 WP_012428210.1.30149 gi|187921041|ref|YP_001890073.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]