SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 398577.BamMC406_0346 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398577.BamMC406_0346
Domain Number 1 Region: 11-86
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000177
Family Anti-sigma factor antagonist SpoIIaa 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 398577.BamMC406_0346
Sequence length 91
Comment (Burkholderia ambifaria MC40 6)
Sequence
MSGFAAGSSLTVASAKSALADGLARIDAGATAVDCAALTQFDSSALAVLLAWQRAAKARS
ATLDILNLPPKLASLANAYGVDALIEGTGRH
Download sequence
Identical sequences B1YRU9
WP_012362927.1.54386 gi|172059411|ref|YP_001807063.1| 398577.BamMC406_0346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]