SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 398577.BamMC406_1077 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398577.BamMC406_1077
Domain Number 1 Region: 260-311
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000134
Family AraC type transcriptional activator 0.02
Further Details:      
 
Domain Number 2 Region: 208-257
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000224
Family Tetracyclin repressor-like, N-terminal domain 0.075
Further Details:      
 
Weak hits

Sequence:  398577.BamMC406_1077
Domain Number - Region: 58-104,143-189
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.00051
Family Regulatory protein AraC 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 398577.BamMC406_1077
Sequence length 320
Comment (Burkholderia ambifaria MC40 6)
Sequence
MTTDLLSDVLTDLRADAVVTGRFTLSAPWAIRKPAVAGAPFRTCAGSPFFLVVAGAAPVH
VEPGDFVLLPHGDEHVMASSLDEPPVPFDTLMADKGIRPRFDTPLEFVAGGGGATSDLYT
GIVIYRDIVRSPLFSVLPPLIHVRANDAAVAPWLASTLQSFIEESMACQPGWAVAATRLA
DVLFVQLLRAHLQSSANHTGWLRGLTDAQIGRAMALMHRDPRRDWQLASLAAEAGMSRSR
FCARFAELVGETPIGHLTAYRMYLASGELAHGKLRLIEIAERVGYTSEKAFARAFHRWSG
MAPRRYARNAQDLYDLARHG
Download sequence
Identical sequences B1YW32
gi|172060132|ref|YP_001807784.1| 398577.BamMC406_1077 WP_012363458.1.54386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]