SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 398577.BamMC406_2851 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398577.BamMC406_2851
Domain Number 1 Region: 731-968
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.01e-23
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.02
Further Details:      
 
Domain Number 2 Region: 27-219
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.53e-17
Family Pyruvate oxidase and decarboxylase Pyr module 0.046
Further Details:      
 
Domain Number 3 Region: 441-628
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000252
Family Pyruvate oxidase and decarboxylase PP module 0.082
Further Details:      
 
Weak hits

Sequence:  398577.BamMC406_2851
Domain Number - Region: 276-404
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00102
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 398577.BamMC406_2851
Sequence length 1190
Comment (Burkholderia ambifaria MC40 6)
Sequence
MIARLPVDGTPALSDYRLTDNLTATRGRIFLTGTQALVRLLLMQRASDVAQGLNTAGFVS
GYRGSPLGMVDQQLWKAKKLLDGSGVRFLPAINEELGGTAVLGTQRVEADPERTVDGVYA
MWYGKGPGVDRAGDALKHGNAYGSSPHGGVLVVAGDDHGCVSSSMPHQSDFAMIAWHMPV
VNPSNIADMLEFGLYGWALSRYSGAWVGFKAISETVESGSTVDLDALQTQWPAPAGFTPP
AGGLHNRWPDLPSLTIEARLAAKLDAVRHFARSNSIDKWIAPSAQANVGIVTCGKAHLDL
MEALRRLDLTVADLDAAGVRIYKVGLSYPLEMTRIETFVDGLAEVLVIEEKGPVIEQQIK
DYLYNRADGARPRVLGKHDATGACLLSELGELRPSRILPVFAEWLARHKPALDRRERVVD
LVAPRILSNEADAVKRTPYFCSGCPHNTSTKVPEGSIAQAGIGCHFMASWMERDTTGLIQ
MGGEGVDWAAHAMFTNTKHVFQNLGDGTYFHSGILAIRQAVAAKANITYKILYNDAVAMT
GGQPVDGSISVPQIARQVEAEGVSRFVVVSDEPEKYDGHHGQFPAGTTFHHRSELDTVQR
ELRETPGVTVLIYDQTCAAEKRRRRKKGEFPDPDKRLFINDAVCEGCGDCGVQSNCLSVE
PLETPLGRKRRIDQSSCNKDYSCVNGFCPSFVTVEGAALKKAAGAAFDEATLAARVDALP
VPATHLDAAPFDMLVTGVGGTGVVTVGALISMAAHLEGKSASVLDFMGFAQKGGSVLSFV
RIASSDQWLNQVRIDTQQADVLLACDMVVGASAEALQTVRHERSRIVVNTHRIPNASFVQ
DPDANLHADALLEKMHHAAGDGYLSSCDAQALAAKFLGDSIGANILMLGYAWQLGLVPVS
LAAMMRAIELNNVAVPMNKLAFSIGRMAAGDAAGLDALWNARHTVAAQAAPETLAELIAD
REARLDAYGGARYVERYRALVNAARAKGDDALTRAVATTFYRLLAVKDEYEVARLYADGA
FRTALEGQFEGVPGQDYRVKFNLAPPTVAKAGRDGSAPKKRVFGQWMWPVFGMLARVRSL
RGTWFDPFGRTAERRMERALADDYETTLTRALAALTAGNAAQVAQLADLHARVRGFGHVK
VRNLAGVKRTERELALQLGIDAATSAAVQHALDEMKGAGMLKGIPVVVAK
Download sequence
Identical sequences B1YNS7
gi|172061891|ref|YP_001809543.1| 398577.BamMC406_2851 WP_012364837.1.54386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]