SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 398577.BamMC406_4906 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398577.BamMC406_4906
Domain Number 1 Region: 54-164,208-262
Classification Level Classification E-value
Superfamily ClpP/crotonase 6.7e-26
Family Crotonase-like 0.069
Further Details:      
 
Domain Number 2 Region: 462-513
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000012
Family NfeD domain-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 398577.BamMC406_4906
Sequence length 528
Comment (Burkholderia ambifaria MC40 6)
Sequence
MPIHRHGPPSSASPDGRPRHPLVARVARAALFAALLVVCAAVAAPPPASSPAAPAAAPPV
IVIPVNGAIGPASADFIVRSIERAAHDHAPLAILQLDTPGGLDTSMRQIIKAILGSPVPV
AAFVAPGGARAASAGTYIVYASHVAAMAPGTNLGAASPVQFGIGGGAPGTPGTPGTPGTP
RPSPAGTSGAGGASGASSTPVALPNDTQSTEIRKATQDAAAYIRGLAQLRGRNAEWAERA
VREAVSLSANEARAQHVVDLIAQDPADLARQLDGRTVTTSAGTLHLATAHAPLVVLAPDW
RSRFLSIIADPNVALILLTIGIYGLFFEFANPGFVLPGLAGTICLLVGLFAMQLLPVSYA
GLGLVLLGLGCLVAEAFLPTFGVLGFGGIVSFTIGALMLIDTDVPGYGIPWPVIASLALG
GALFVAVVSSVALRARRRPVVTGAEAMLGSIGEVLDDGLHPDQPMGASGVAPSAAGWARV
HGERWRVASSVPLAAGCRVRVTGRQGLTLTVTPLYDVPGQAQPQGEPS
Download sequence
Identical sequences B1YZ56
gi|172063918|ref|YP_001811569.1| 398577.BamMC406_4906 WP_012366635.1.54386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]