SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 398577.BamMC406_4969 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398577.BamMC406_4969
Domain Number 1 Region: 183-424
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.31e-70
Family D-glucarate dehydratase-like 0.000000115
Further Details:      
 
Domain Number 2 Region: 4-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.55e-41
Family Enolase N-terminal domain-like 0.00000307
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 398577.BamMC406_4969
Sequence length 425
Comment (Burkholderia ambifaria MC40 6)
Sequence
MPIIRSMRVLDVRFPTSRELDGSDAMNPDPDYSAAYVVLETDHDGLEGHGLTFTIGRGNE
ICCAAIDAMRHLVVGLDLDWIREDMGRFWRHVTSDSQLRWIGPDKGAIHLATGAVVNAVW
DLWAKAAGKPLWRLVADMSPEEIVRAIDFRYLTDCLTQEEALALLRRQAPGKAARIATLE
RDGYPCYTTSAGWLGYSDDKLRRLCREAVDAGFDYVKLKVGANLEDDIRRVTIAREVIGP
ERKLMIDANQVWEVDEAIDWVRELAFAKPWFIEEPTSPDDVEGHRKIREAIAPVQVATGE
MCQNRVLFKQFIARGAIDVVQIDACRLGGVNEILAVMLLAAKYGLPVCPHAGGVGLCEYV
QHLSMIDYVCISGTKEGRVTEYVDHLHEHFVEPCVVRGAAYMPPTAPGFSIEMKPASLEQ
YRFRG
Download sequence
Identical sequences B1YZL5
gi|172063980|ref|YP_001811631.1| WP_012366689.1.54386 398577.BamMC406_4969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]