SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 398577.BamMC406_5132 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398577.BamMC406_5132
Domain Number 1 Region: 98-386
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.44e-76
Family D-glucarate dehydratase-like 0.00019
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.21e-34
Family Enolase N-terminal domain-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 398577.BamMC406_5132
Sequence length 402
Comment (Burkholderia ambifaria MC40 6)
Sequence
MKIERLQTIVTCPGRNFVTVKIVTDEGVHGLGDATLNGRELAVRAYLEDHVFPCLVGRDP
RNIEDIWQYLYRGAYWRRGPVTMTAIAAIDMALWDILGKLAGMPVYRLLGGKSRDGLMVY
GHANGRDHEEAVDAVRAHIEAGYRAIRVQSGVPGLDKVYGVGKTAGAYEPAEKGLPPEEP
WDTALYLRHTPELFRKVRDAVGDAPHLLHDAHHRLTPIEAARLGRDLEPHRLFWLEDATP
AENQDAFRLIRQHTTTPLAVGEVFNSIWDCKDLIRDQLIDYIRATIVHAGGITHVRRIAD
YAAMYQVRTGFHGATDLSPVCMAAAVNFGLWAPNFGIQELMPHSALTDEVFPHNYRLEDG
YLVMDDVPGLGVDIDETQAAKYPYERAYLPVARLRDGSMWNW
Download sequence
Identical sequences B1Z0M6
gi|172064143|ref|YP_001811794.1| WP_012366825.1.54386 398577.BamMC406_5132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]