SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 398577.BamMC406_6282 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398577.BamMC406_6282
Domain Number 1 Region: 115-364
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 6.16e-61
Family D-glucarate dehydratase-like 0.00034
Further Details:      
 
Domain Number 2 Region: 9-128
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.59e-26
Family Enolase N-terminal domain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 398577.BamMC406_6282
Sequence length 366
Comment (Burkholderia ambifaria MC40 6)
Sequence
MALSDAPAIDDVRARAYRVPTDRPEADGTFAWHATTIVVVEIDAGPVTGLGYTYTDASAA
LLAKSMLADVLRERPLVDIPAAVDALWRAVRNVGRAGVAATAISALDVALWDAKAKLAGV
PLAILLGRVRERVPVYGSGGFTTYDDATLAAQLDGWRNEHIRACKIKIGAQDARDPSRVR
VARAALGPDVDLFVDANGAYAARTALAFAESVADCAIRWFEEPVSSDDIDGLRFVREHVG
ACVDVAAGEYAYTPDDFRRLLEGRAVDVLQADATRCGGVSGFLAAAALADAHHVDLSAHC
APALHRQVGCVAPRMRHVEWFHDHVRIERMMFDGAPTVVDGALEIDAARPGLGLELREAD
VAQFAI
Download sequence
Identical sequences B1Z4Q2
WP_012372600.1.54386 gi|172065556|ref|YP_001816268.1| 398577.BamMC406_6282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]