SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 398578.Daci_3356 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398578.Daci_3356
Domain Number 1 Region: 138-422
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.41e-115
Family Enolase 0.0000000958
Further Details:      
 
Domain Number 2 Region: 3-135
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.47e-47
Family Enolase N-terminal domain-like 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 398578.Daci_3356
Sequence length 441
Comment (Delftia acidovorans SPH-1)
Sequence
MQITDIAAHEALDSRGHPTVEVEVELADGSRGLALVPSGASTGRHEALERRDGDASRHLG
KGVLGAVQAVNTELRDLLRGMRADAQGRIDTAMIALDGTPGKSRLGANALLGVSLAVARA
AAASQRMPLWRHMGGAQARVLPVPMINVINGGAHADNPLDFQEFMLLPVGADSFREALRM
GAEVFHTLRHALKAAGHSVNVGDEGGFAPALRSAPEALDHLMAAIERAGLRPGRDIALAL
DPAASEFHGEDGYRYAGEGLVRSRQQQVDYLAQLVEHYPIVSIEDGMAEDDIEGWQALGR
RLGGRCQLVGDDVFCTNPGLFEGGIARGVGNAILVKINQIGTLTETWDVLRLAHGAGYGV
VMSHRSGETEDTSIADLAVAAQCAMIKTGSLSRADRTAKYNRLLRIERELGPAAVYAGRR
ALKGRAGQEAVSAAAGVAGAL
Download sequence
Identical sequences A9BZT6
gi|160898797|ref|YP_001564379.1| 398578.Daci_3356 WP_012205194.1.82428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]