SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 398578.Daci_4410 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398578.Daci_4410
Domain Number 1 Region: 3-114
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000131
Family Anti-sigma factor antagonist SpoIIaa 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 398578.Daci_4410
Sequence length 124
Comment (Delftia acidovorans SPH-1)
Sequence
MDRIPILRMGDVLLVSIQIDMQDQTALALQDDLAERIASTGASGVMIDISALEVVDSFVG
RMLVTISGIARILSAATVVVGMQPAVAITLVELGLSLGGVRTAMTVERGMALLRAQQSGA
TLGT
Download sequence
Identical sequences A0A031I4P4 A0A1C7LDP2 A0A210W6M6 A0A286IY72 A0A2G6TTU7 A0A2G6WBH0 A0A2G7SYU1 A9C0G8 F6AZA4
398578.Daci_4410 gi|160899844|ref|YP_001565426.1| gi|333914042|ref|YP_004487774.1| WP_012206213.1.1853 WP_012206213.1.32055 WP_012206213.1.37708 WP_012206213.1.66548 WP_012206213.1.82428 WP_012206213.1.86732 WP_012206213.1.89816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]