SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 398578.Daci_5531 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398578.Daci_5531
Domain Number 1 Region: 3-88
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000392
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 398578.Daci_5531
Sequence length 93
Comment (Delftia acidovorans SPH-1)
Sequence
MLQLPRELTYRQARSCLVQLRPQVQAFDGAQVRVDASGVEVFDSAALAVLLACRRTAKAA
DKQLVVVGLPQGLQSMAALYGVDGLLTDASSPS
Download sequence
Identical sequences A9BX84 S2X3D8
398578.Daci_5531 gi|160900963|ref|YP_001566545.1| WP_012207329.1.76905 WP_012207329.1.82428 WP_012207329.1.89816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]