SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 398579.Spea_0462 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  398579.Spea_0462
Domain Number - Region: 100-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00123
Family NfeD domain-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 398579.Spea_0462
Sequence length 159
Comment (Shewanella pealeana ATCC 700345)
Sequence
MEFSNPIIIWACIGVILVLAEIILPGGIVILLGAACLVVASALAIGLVEGIVQSLTLWFI
SSMVLLLTFRQVTQKLIGGDAHIGNTDEELDIYDQLAIVKQTIGPAQQMGRVEFQGCEWS
ALGDGSEIAAGSQVRVICRDNIALVVEPIKAEDEHYVEK
Download sequence
Identical sequences A8GZQ3
WP_012153728.1.79101 398579.Spea_0462 gi|157960291|ref|YP_001500325.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]