SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 398767.Glov_1629 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  398767.Glov_1629
Domain Number 1 Region: 4-177
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.09e-36
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 398767.Glov_1629
Sequence length 181
Comment (Geobacter lovleyi SZ)
Sequence
MARYELRFSGAGGQGLITAGIILAEAASIHEGKQAVQSQSYGPEARGGASKSEVIIDDVP
VDYPKATKVDALLALTQEACDKYSADLKDSGILLYDTDLVTKLPEGGFKKVGFNIINTAK
NEVGREIVANIVALGAMIALTGVVSRENGLKAVLSRVPEAFLELNEKAYAAGFDKAKAAA
A
Download sequence
Identical sequences B3E9R9
gi|189424688|ref|YP_001951865.1| 398767.Glov_1629 WP_012469687.1.41214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]