SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE000290 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE000290
Domain Number 1 Region: 250-476
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.97e-50
Family D-glucarate dehydratase-like 0.0000709
Further Details:      
 
Domain Number 2 Region: 125-247
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.25e-22
Family Enolase N-terminal domain-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE000290
Sequence length 487
Comment (Oryza indica)
Sequence
MSNLRTNSYSIKEKLVVVFLLEPLHKIRQNPVLQSVAVAVAMDSAISTSSSFSPLRLSQN
HGSIMSGSTRAQVLPVGRQQQQPPAGGATRLRAVSPSPSPTPPAPQPAETFGFDALKEAF
SVDVVAAEARPLNVPLAAPFTIASSRLDAVSNVAVRVELRSGAVGWGEAPVLPSVTAEDQ
PGALAAATRACGALAGAPAAPLGAVLQDVASALPGHDFASARAGVEMALIDAIANSIRIP
LWRLFGGASDSVTTDITIPIVTPNEAAQLATKYRGQGFQTLKLKVGKNLNSDIEVLKAIR
LAHPDCSFILDANEGYTANQAIEALDRLNEMGVTPVLFEQPVHRDDWEGLRDVSIVAKEK
YRVAVAADESCRSLLDAQKIMDGNLAHVINIKLAKLGILGALEVIDAARKARIALMIGGM
VETRIAMGFAGHLAAGLGCFSFVDLDTPLLLSEDPVFGGYEVSGPVYKFTNARGHGGFLH
LDNNGLK
Download sequence
Identical sequences OsIBCD000260 39946.BGIOSIBCE000290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]