SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE003108 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE003108
Domain Number 1 Region: 77-149
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.76e-17
Family Splicing factor U2AF subunits 0.0051
Further Details:      
 
Weak hits

Sequence:  39946.BGIOSIBCE003108
Domain Number - Region: 16-41
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000249
Family CCCH zinc finger 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE003108
Sequence length 265
Comment (Oryza indica)
Sequence
MAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSRLHNRPTISPTVVFANMYQRPDMITP
GVDAQGQPIDPRQMQEHFEDFYEDIFEELSKFGEIENLNVCDNLADHMIGNVYVQFREED
QAAAAHTALQGRFYSGRPIIVDFSPVTDFREATCRQLGLGRDLRKKLFGHYRKPQRGRSR
SPSPSPSPRHRRERHDRDDYRGRDDYSGGGGRRGGSSRHERHDDGGRRRHGGSPPRRARS
PVRESSEERRAKIEQWNRERDEKQG
Download sequence
Identical sequences A2WTL5
39946.BGIOSIBCE003108 OsIBCD002853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]