SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 39946.BGIOSIBCE010482 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  39946.BGIOSIBCE010482
Domain Number 1 Region: 185-459
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.03e-82
Family Enolase 0.00000044
Further Details:      
 
Domain Number 2 Region: 46-181
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.87e-34
Family Enolase N-terminal domain-like 0.0000426
Further Details:      
 
Weak hits

Sequence:  39946.BGIOSIBCE010482
Domain Number - Region: 3-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0628
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 39946.BGIOSIBCE010482
Sequence length 465
Comment (Oryza indica)
Sequence
MSVQEYLEKHLLSRKIEEAVNAAVRAKAPDPVLFISNHMRRAAPAVITSVRARQILDGRG
EPAVEVSLHTNKAVHRASAAAADAPEGAAADAVRDAEKRKLLARAVADAVRVINDKVSEA
LVGMDPQQQSQIDQAIMDLDKAHHKAEIGVNSMLAVSIAACKAGAAEKEVPLYKHIAELV
GKSATTLPIPAITVINGGTHAGNSLPIQEIMILPVGAKNFEEAMQMGSETYHHLKDIILE
KYGSNSCNIGDDGGFAPNISRQWNYAIQYCWSAINLMAYINRTTLNHRSRELEQQLECVV
CYGNKYDMEFKFAEKSGQGFKTADDLIEIYSQLCSVSHDITFVQVVGDDLLMSDPERIKR
AVNEYTCNALVLKANQVGTVTEAIEVVRQAKDAHWGVMVSHRSGDTDDSFIADLAVGAAA
GQIKAGAPCRGECLSKYNQLLRIEEELGSDGVYAGENWRTTASTS
Download sequence
Identical sequences 39946.BGIOSIBCE010482 OsIBCD009573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]